PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn302321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 264aa    MW: 29364.1 Da    PI: 8.4881
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn302321genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-141056148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd+ll+ av+++  ++W +Ia++++ +Rt+ q  +rwqk+l
       Achn302321 10 KGGWTEEEDKLLALAVQKFNEKNWQKIAECVP-NRTEVQWLHRWQKVL 56
                     688*****************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.624560IPR017930Myb domain
SuperFamilySSF466892.21E-19897IPR009057Homeodomain-like
SMARTSM007171.6E-12958IPR001005SANT/Myb domain
PfamPF002492.5E-131056IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-181268IPR009057Homeodomain-like
CDDcd001671.15E-121356No hitNo description
PROSITE profilePS500906.3195796IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.9E-56990IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MTGPTRRASK GGWTEEEDKL LALAVQKFNE KNWQKIAECV PNRTEVQWLH RWQKVLNPNL  60
VKGPWTKTED ELIIELFSKQ ENHKWQFRER DIHNKTSFVN CVGSGDSNPL KLGYGPLQGD  120
DSTIFVKSTP VSFANPNTHK SNDCRSPESV LRSKAMSYKN RPSIIRKRGL QTFSQGFNKS  180
FDDCLSEENS GILNSGLVLP NTEVVLLFPA KPRKLESSGP IKSVGKHLVF AFDDVCDKLN  240
VLTEGDASGV GHDSDVSVTF SGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-171085681MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-171085681MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1748824
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.28e-31Homeodomain-like protein